RetrogeneDB ID: | retro_ttru_1611 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
Coordinates: | scaffold_60817:111..351(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ELOF1 | ||
Ensembl ID: | ENSTTRG00000001807 | ||
Aliases: | None | ||
Description: | elongation factor 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:28691] |
Percent Identity: | 83.75 % |
Parental protein coverage: | 96.39 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | RRKSKRKPPPKKKMTGTLETQFTCPFCNHEKSCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYS |
RRKSK.KPPPKKKMT..L..QFTCPFCNHEKSCD.KMD.A.NTGVISCT.CLE.FQTPITYL..PVDVYS | |
Retrocopy | RRKSKQKPPPKKKMTVSLDAQFTCPFCNHEKSCDMKMDQAHNTGVISCTMCLE*FQTPITYLYTPVDVYS |
Parental | DWIDACEAAN |
DWI.ACEAAN | |
Retrocopy | DWIEACEAAN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000064 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000020359 | 1 retrocopy | |
Felis catus | ENSFCAG00000004926 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000001534 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000012101 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000026211 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003687 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000004812 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000001807 | 1 retrocopy |
retro_ttru_1611 ,
|