RetrogeneDB ID: | retro_acar_105 | ||
Retrocopylocation | Organism: | Anole lizard (Anolis carolinensis) | |
Coordinates: | 3:72022621..72022968(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMEM147 | ||
Ensembl ID: | ENSACAG00000010132 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 85.47 % |
Parental protein coverage: | 51.56 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MTLFHFGNC-FALAYFPYFITYKCSGLSEYNAFWRCVQAGATYLFVQLCKMLFLATFFPTWEGGAGAYDF |
MTL.H.GN..FALAYFPYFITYKCSGLS.YNAFWRC.QAGATYLFVQLCKMLFL.TFFPTWEGG.G.YDF | |
Retrocopy | MTLIHSGNF<FALAYFPYFITYKCSGLSDYNAFWRCIQAGATYLFVQLCKMLFLTTFFPTWEGGTGVYDF |
Parental | VGEFMKATVDLADLVGLHLVMSRNAGKGEYKIMVAAMGWATAELIMS |
.GEFMKATV.LADL.GLHLVMS.NA.KGEYKIMV.AMGWATAE.I.S | |
Retrocopy | FGEFMKATVNLADLMGLHLVMSWNANKGEYKIMVLAMGWATAEIILS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP009831_adrenal | 0 .00 RPM | 22 .15 RPM |
SRP009831_brain | 0 .00 RPM | 25 .09 RPM |
SRP009831_dewlap | 0 .00 RPM | 84 .12 RPM |
SRP009831_embryo | 0 .03 RPM | 32 .22 RPM |
SRP009831_heart | 0 .00 RPM | 23 .71 RPM |
SRP009831_liver | 0 .00 RPM | 28 .51 RPM |
SRP009831_lung | 0 .00 RPM | 15 .87 RPM |
SRP009831_ovary | 0 .04 RPM | 87 .91 RPM |
SRP009831_skeletal_muscle | 0 .00 RPM | 20 .87 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000010132 | 1 retrocopy |
retro_acar_105 ,
|
Ailuropoda melanoleuca | ENSAMEG00000000375 | 1 retrocopy | |
Bos taurus | ENSBTAG00000015920 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000006960 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000004059 | 1 retrocopy | |
Felis catus | ENSFCAG00000006373 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000016383 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000006709 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000008207 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000015114 | 2 retrocopies |