RetrogeneDB ID: | retro_bole_65 | ||
Retrocopylocation | Organism: | Brassica oleracea | |
Coordinates: | C8:27376557..27376767(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | Bo1g024160 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 52.05 % |
Parental protein coverage: | 59.35 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | KPPLRSTSGGVVRVVLFFLHHGFVPLGFPDKLADVVKHFSAKYGKDFVSAAVGLQSDSGVSRLLVDKLSV |
.P.LR.TSGGVVRVVLFFLHHGFVPLGFPDK.........A.Y....V.A..G.......S.L...K..V | |
Retrocopy | EPTLRFTSGGVVRVVLFFLHHGFVPLGFPDKV--LMRQHEAYYRSCMVMASKG-ECYKSWSGLPLTKTRV |
Parental | KAP |
..P | |
Retrocopy | ESP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Brassica oleracea | Bo1g024160 | 3 retrocopies |
retro_bole_39, retro_bole_65 , retro_bole_69,
|