RetrogeneDB ID: | retro_cfam_1820 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 6:41216191..41216398(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSCAFG00000019775 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FXYD4 | ||
Ensembl ID: | ENSCAFG00000024923 | ||
Aliases: | None | ||
Description: | FXYD domain containing ion transport regulator 4 [Source:HGNC Symbol;Acc:4028] |
Percent Identity: | 76.81 % |
Parental protein coverage: | 78.41 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | GLPALEANDLVDKDSPFYYDWESLQLGGMIFGGLLCIAGILIALSGKCKCKYNQKHSPLPEKATPLITP |
G.PALEA.DLVDKDSP.YYDWESLQLGGMIFGGLLCIAGILIALSGKCKCKY.....PL......L..P | |
Retrocopy | GRPALEASDLVDKDSPLYYDWESLQLGGMIFGGLLCIAGILIALSGKCKCKYPYRRKPLHSSLQALSVP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 0 .34 RPM |
SRP017611_brain | 0 .00 RPM | 0 .16 RPM |
SRP017611_kidney | 0 .00 RPM | 13 .08 RPM |
SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000024923 | 1 retrocopy |
retro_cfam_1820 ,
|
Dasypus novemcinctus | ENSDNOG00000017385 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000010030 | 4 retrocopies | |
Felis catus | ENSFCAG00000022417 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000027578 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000006722 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000016033 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000014460 | 3 retrocopies |