RetrogeneDB ID: | retro_cfam_856 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 19:3653314..3653655(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS18 | ||
| Ensembl ID: | ENSCAFG00000000950 | ||
| Aliases: | None | ||
| Description: | Canis lupus familiaris ribosomal protein S18 (RPS18), mRNA. [Source:RefSeq mRNA;Acc:NM_001048082] |
| Percent Identity: | 61.86 % |
| Parental protein coverage: | 75.66 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | IAFAITAIKGVGRRYAHVVLRKADID-LTKRAGELTEDEVERVITIMQNPRQYKIPD-WFLNRQKDVKDG |
| IAFAITA...VGR..A.V.LRK.D...LTKRA.ELTED...RV.T.MQN..Q.KIP....LNRQKD.KDG | |
| Retrocopy | IAFAITAANSVGRSCAPVTLRKTDVS<LTKRARELTEDDMGRVATTMQNLSQCKIPN>GLLNRQKDEKDG |
| Parental | KYSQVLANGLDNKLREDLERLKKIRAHRG-LRHFWGLRVRGQHTKTTG |
| ..SQV.A.GLDNKL.EDLE...K.RA..G.L.H.WGL.V.G..T..TG | |
| Retrocopy | EDSQVPASGLDNKLCEDLE*V-KMRAPGG<LSHSWGLCVGGRPTTITG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 228 .26 RPM |
| SRP017611_brain | 0 .00 RPM | 90 .43 RPM |
| SRP017611_kidney | 0 .00 RPM | 675 .30 RPM |
| SRP017611_liver | 0 .00 RPM | 191 .73 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000000950 | 7 retrocopies |
retro_cfam_1311, retro_cfam_1607, retro_cfam_2132, retro_cfam_414, retro_cfam_522, retro_cfam_789, retro_cfam_856 ,
|
| Dipodomys ordii | ENSDORG00000013825 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000006571 | 5 retrocopies | |
| Loxodonta africana | ENSLAFG00000032173 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000003867 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000008668 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006840 | 10 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000010546 | 1 retrocopy | |
| Procavia capensis | ENSPCAG00000005854 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000025953 | 14 retrocopies | |
| Pan troglodytes | ENSPTRG00000018039 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000028505 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000006857 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000008658 | 1 retrocopy |