RetrogeneDB ID: | retro_chof_1676 | ||
Retrocopylocation | Organism: | Sloth (Choloepus hoffmanni) | |
Coordinates: | scaffold_35593:12169..12391(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS15A | ||
Ensembl ID: | ENSCHOG00000012210 | ||
Aliases: | None | ||
Description: | ribosomal protein S15a [Source:HGNC Symbol;Acc:10389] |
Percent Identity: | 64.47 % |
Parental protein coverage: | 57.36 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | RAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQ-NNLLPSRQFGFIVLTTSAGIMD-HEEARRKHTGGK |
.A..I.V.LTGRLN..G.IS.R..VQLKDLEKWQ...LL.S..FGF..L.TSA.I.D.HE.ARRK.TG.. | |
Retrocopy | KAAEIRVSLTGRLNVGGGISSRLAVQLKDLEKWQ>KSLLLSHRFGFVALMTSADIRD<HEGARRKSTGVR |
Parental | ILGFFF |
ILGFFF | |
Retrocopy | ILGFFF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000012210 | 12 retrocopies | |
Gadus morhua | ENSGMOG00000005862 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000011476 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000026996 | 13 retrocopies |