RetrogeneDB ID: | retro_chof_1676 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_35593:12169..12391(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS15A | ||
| Ensembl ID: | ENSCHOG00000012210 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S15a [Source:HGNC Symbol;Acc:10389] |
| Percent Identity: | 64.47 % |
| Parental protein coverage: | 57.36 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | RAGKIVVNLTGRLNKCGVISPRFDVQLKDLEKWQ-NNLLPSRQFGFIVLTTSAGIMD-HEEARRKHTGGK |
| .A..I.V.LTGRLN..G.IS.R..VQLKDLEKWQ...LL.S..FGF..L.TSA.I.D.HE.ARRK.TG.. | |
| Retrocopy | KAAEIRVSLTGRLNVGGGISSRLAVQLKDLEKWQ>KSLLLSHRFGFVALMTSADIRD<HEGARRKSTGVR |
| Parental | ILGFFF |
| ILGFFF | |
| Retrocopy | ILGFFF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012210 | 12 retrocopies | |
| Gadus morhua | ENSGMOG00000005862 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000011476 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000026996 | 13 retrocopies |