RetrogeneDB ID: | retro_chof_1902 | ||
Retrocopy location | Organism: | Sloth (Choloepus hoffmanni) | |
| Coordinates: | scaffold_41929:6555..6791(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PQLC3 | ||
| Ensembl ID: | ENSCHOG00000006017 | ||
| Aliases: | None | ||
| Description: | PQ loop repeat containing 3 [Source:HGNC Symbol;Acc:28503] |
| Percent Identity: | 72.5 % |
| Parental protein coverage: | 75.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | NLCTFISAAS-KFAQLQYLWKTRDS-GAVSALTWSLASYTCATRIVTTLMTTNDLTILTRFVIMLALNIW |
| .LCTFISAAS.KFAQ.QYLWKTR.S.GAVSAL...L..YT..TRIVT.L.T.NDL.IL..FVIMLALN.. | |
| Retrocopy | DLCTFISAAS>KFAQPQYLWKTRGS>GAVSALS*NLSLYTFETRIVTILVTPNDLIILKSFVIMLALNVR |
| Parental | VTATILHYRK |
| VTATILHY.. | |
| Retrocopy | VTATILHYEE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006017 | 3 retrocopies |
retro_chof_1902 , retro_chof_2195, retro_chof_717,
|
| Callithrix jacchus | ENSCJAG00000006801 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000015960 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000009376 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000045679 | 2 retrocopies |