RetrogeneDB ID: | retro_cjac_1178 | ||
Retrocopy location | Organism: | Marmoset (Callithrix jacchus) | |
| Coordinates: | 14:4548787..4549128(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RAB31 | ||
| Ensembl ID: | ENSCJAG00000004529 | ||
| Aliases: | None | ||
| Description: | RAB31, member RAS oncogene family [Source:HGNC Symbol;Acc:9771] |
| Percent Identity: | 72.65 % |
| Parental protein coverage: | 57.95 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 4 |
| Parental | VIVYDIT-KQDSFYTLKKWVKELKEHGPENIVMAIAG-NKCDLSDIREVPLKDAKEYAESIGAI-VVETS |
| ..V.D.T.KQDSF.TLKKW..ELKEHGPENI.M.IA..NKC.LSDIRE..LKDA.EYAE.IGAI.VVE.. | |
| Retrocopy | ITVHDVT>KQDSFHTLKKWDEELKEHGPENIQMVIAE<NKCHLSDIREIFLKDAEEYAEFIGAI>VVEAR |
| Parental | AK-NAINIEELFQGISRQIPPLDHHENGNNGAIKLVKQTTQASRRCC |
| AK.N.INIEELFQGIS.QIP.LD.HENGNNG...L..QT.QAS.RCC | |
| Retrocopy | AK>NPINIEELFQGISHQIPALDPHENGNNGVRRLGEQTMQASLRCC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP051959_colon | 0 .00 RPM | 25 .12 RPM |
| SRP051959_heart | 0 .00 RPM | 43 .43 RPM |
| SRP051959_kidney | 0 .00 RPM | 33 .30 RPM |
| SRP051959_liver | 0 .00 RPM | 41 .63 RPM |
| SRP051959_lung | 0 .00 RPM | 68 .62 RPM |
| SRP051959_lymph_node | 0 .00 RPM | 19 .25 RPM |
| SRP051959_skeletal_muscle | 0 .00 RPM | 7 .29 RPM |
| SRP051959_spleen | 0 .00 RPM | 64 .77 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000000472 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000003731 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004529 | 2 retrocopies |
retro_cjac_1178 , retro_cjac_1179,
|
| Callithrix jacchus | ENSCJAG00000007527 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000019039 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000002882 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005692 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000021443 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000016514 | 1 retrocopy |