RetrogeneDB ID: | retro_cpor_1298 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_67:4277929..4278168(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | TMEM18 | ||
| Ensembl ID: | ENSCPOG00000012522 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 68.29 % |
| Parental protein coverage: | 57.86 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | SYFPVSIPSVIMQTDWTEPWLLGLVAFHVLCLLLTC-FSAQRYQLQVGLFLSLAALVYCAEYINEVAAMN |
| S.FP.SIP.VI..TDWTEPWLLG...FH.L.LLLT..FS.QR..LQ..LFL.L.A.VYC.E.INEVAA.N | |
| Retrocopy | STFPASIPAVI-RTDWTEPWLLGPAVFHILFLLLTT<FSSQRHRLQTVLFLCLIASVYCIEHINEVAAVN |
| Parental | WRSFSKYQYFDS |
| .R.F.KYQYFDS | |
| Retrocopy | LRLFPKYQYFDS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 3 .51 RPM |
| SRP017611_kidney | 0 .00 RPM | 13 .40 RPM |
| SRP017611_liver | 0 .00 RPM | 6 .66 RPM |
| SRP040447_lung | 0 .00 RPM | 14 .88 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 3 .29 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000000543 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012522 | 1 retrocopy |
retro_cpor_1298 ,
|
| Dipodomys ordii | ENSDORG00000001854 | 1 retrocopy | |
| Equus caballus | ENSECAG00000008640 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000014284 | 1 retrocopy |