RetrogeneDB ID: | retro_ecab_596 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 22:34818278..34818509(-) | ||
Located in intron of: | ENSECAG00000021884 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMEM18 | ||
Ensembl ID: | ENSECAG00000008640 | ||
Aliases: | None | ||
Description: | transmembrane protein 18 [Source:HGNC Symbol;Acc:25257] |
Percent Identity: | 74.36 % |
Parental protein coverage: | 55.71 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MPSPFSVSSFPVSIPAVIAQTDWTEPWLLGLGGFHLLCLLLTWFSSKRYRLQVGHFLCLIALVCCAESIN |
M.S.FSVSSFP.SIPAVI.QTD.TE..L.GL.GFH...LLLT.FS..RY.L.VGHFLCLI.LVCCAE.IN | |
Retrocopy | MLSAFSVSSFPTSIPAVIMQTDRTELRLIGLPGFHVVWLLLTCFSFQRYKL*VGHFLCLI-LVCCAEYIN |
Parental | EVAALNWR |
EVAA.NWR | |
Retrocopy | EVAAMNWR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .30 RPM | 6 .91 RPM |
SRP021940_cerebellum | 0 .05 RPM | 12 .93 RPM |
SRP021940_embryo | 0 .03 RPM | 12 .27 RPM |
SRP021940_placental_villous | 0 .00 RPM | 9 .24 RPM |
SRP021940_synovial_membrane | 0 .05 RPM | 9 .44 RPM |
SRP021940_testis | 0 .13 RPM | 48 .66 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000543 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000012522 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000001854 | 1 retrocopy | |
Equus caballus | ENSECAG00000008640 | 1 retrocopy |
retro_ecab_596 ,
|
Monodelphis domestica | ENSMODG00000014284 | 1 retrocopy |