RetrogeneDB ID: | retro_cpor_1504 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_9:49916635..49916806(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS28 | ||
Ensembl ID: | ENSCPOG00000022876 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 82.46 % |
Parental protein coverage: | 82.61 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MDTSRVQPIKLARVTKVLGRTGSQGQCTQVRVEFMDDTSRSIIRNVKGPVREGDVLT |
MDTSRVQPIKLARVTK.LGRTGSQGQCT.V.VEF.D.TSRSIIRNV.G.V.EGD..T | |
Retrocopy | MDTSRVQPIKLARVTKALGRTGSQGQCT*VLVEFLDNTSRSIIRNVNGLVHEGDMPT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 35 .83 RPM |
SRP017611_kidney | 0 .10 RPM | 75 .37 RPM |
SRP017611_liver | 0 .09 RPM | 48 .10 RPM |
SRP040447_lung | 0 .08 RPM | 240 .20 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 248 .20 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000004917 | 1 retrocopy | |
Bos taurus | ENSBTAG00000002468 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000022876 | 5 retrocopies | |
Equus caballus | ENSECAG00000017256 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000029923 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000023621 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000028895 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000003890 | 1 retrocopy | |
Mus musculus | ENSMUSG00000067288 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000042886 | 2 retrocopies |