RetrogeneDB ID: | retro_cpor_566 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_2:12426729..12426922(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPP14 | ||
| Ensembl ID: | ENSCPOG00000004281 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 73.13 % |
| Parental protein coverage: | 52.42 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MPASAA-TYERIVYKNFSEY-HYMKVCLEFQDHGVGLNVAQFKQLLVSALKDLFGEVGAALPLDVLT |
| MP.SA....ER.VYKN.SE..HY.KVCL.FQD.G.G.N.AQFK.LLVSAL.DLFGE.GAALPLDVLT | |
| Retrocopy | MPVSAP<ACERTVYKNVSEH<HYVKVCLDFQDRGAGQNAAQFK*LLVSALQDLFGEAGAALPLDVLT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 5 .64 RPM |
| SRP017611_kidney | 0 .00 RPM | 10 .68 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .62 RPM |
| SRP040447_lung | 0 .00 RPM | 6 .20 RPM |
| SRP040447_skeletal_muscle | 0 .00 RPM | 7 .25 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019987 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000004281 | 2 retrocopies |
retro_cpor_476, retro_cpor_566 ,
|
| Dasypus novemcinctus | ENSDNOG00000013439 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000010883 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000014541 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007998 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000022513 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027202 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000039829 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000015394 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013343 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000000935 | 1 retrocopy |