RetrogeneDB ID: | retro_cpor_566 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_2:12426729..12426922(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPP14 | ||
Ensembl ID: | ENSCPOG00000004281 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 73.13 % |
Parental protein coverage: | 52.42 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MPASAA-TYERIVYKNFSEY-HYMKVCLEFQDHGVGLNVAQFKQLLVSALKDLFGEVGAALPLDVLT |
MP.SA....ER.VYKN.SE..HY.KVCL.FQD.G.G.N.AQFK.LLVSAL.DLFGE.GAALPLDVLT | |
Retrocopy | MPVSAP<ACERTVYKNVSEH<HYVKVCLDFQDRGAGQNAAQFK*LLVSALQDLFGEAGAALPLDVLT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 5 .64 RPM |
SRP017611_kidney | 0 .00 RPM | 10 .68 RPM |
SRP017611_liver | 0 .00 RPM | 8 .62 RPM |
SRP040447_lung | 0 .00 RPM | 6 .20 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 7 .25 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000019987 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000004281 | 2 retrocopies |
retro_cpor_476, retro_cpor_566 ,
|
Dasypus novemcinctus | ENSDNOG00000013439 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000010883 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000014541 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000007998 | 1 retrocopy | |
Ornithorhynchus anatinus | ENSOANG00000022513 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000027202 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000039829 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000015394 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013343 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000000935 | 1 retrocopy |