RetrogeneDB ID: | retro_cpor_740 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_26:10652189..10652609(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ATP5S | ||
Ensembl ID: | ENSCPOG00000014471 | ||
Aliases: | None | ||
Description: | ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B) [Source:HGNC Symbol;Acc:18799] |
Percent Identity: | 70. % |
Parental protein coverage: | 70. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | TVRYHGQERWQKDYNQLPTGPLDKYKIQAIDATDSCIMNIGFDHMEGLEHVEKIKLCKCHYIEDDCLLRI |
...Y.GQERWQK..N.LPTGPLDK.KIQAI..T..CI.NIG.DHM..L.HVEKIKL.KC.YIED.CL.RI | |
Retrocopy | SLHYCGQERWQKGSNYLPTGPLDKSKIQAINETEFCINNIGLDHMNRLQHVEKIKLYKCNYIEDECLVRI |
Parental | SQLEKLQKSLLEMEIISCGNVTDKGIVALRHLRNLKYLLLSDLPGVREKENIVQVFKTTLPSLELELQLK |
.Q.E.LQKS.LE..IIS..NVTDKG..AL.HLRNLKYLLLSDL.GVR....IVQVFKT.L..LEL.L.LK | |
Retrocopy | HQHEYLQKSILEIKIISYRNVTDKGTIALHHLRNLKYLLLSDLAGVRXXXXIVQVFKTILS*LELKLKLK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 5 .87 RPM |
SRP017611_kidney | 0 .00 RPM | 7 .22 RPM |
SRP017611_liver | 0 .00 RPM | 8 .01 RPM |
SRP040447_lung | 0 .00 RPM | 3 .25 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 5 .93 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009828 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000014285 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000014471 | 1 retrocopy |
retro_cpor_740 ,
|
Felis catus | ENSFCAG00000029962 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000013773 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000006173 | 1 retrocopy | |
Sorex araneus | ENSSARG00000007707 | 1 retrocopy |