RetrogeneDB ID: | retro_dnov_1407 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_197826:996..1242(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ARF5 | ||
Ensembl ID: | ENSDNOG00000013387 | ||
Aliases: | None | ||
Description: | ADP-ribosylation factor 5 (Predicted) [Source:UniProtKB/TrEMBL;Acc:C0RW27] |
Percent Identity: | 54.88 % |
Parental protein coverage: | 52.23 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 0 |
Parental | ERVQESADELQKMLQEDELRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLY |
E....S..........D.L.DAVLL.FANKQD.PNAM..SE.TDKL.LQ.....T.Y.QAT.ATQGT.LY | |
Retrocopy | ENSRRSRRAAENASRKD*L*DAVLLLFANKQDLPNAMDISEMTDKLSLQSSQNKT*YIQATYATQGTRLY |
Parental | DGLDWLSHELSK |
...D.LS..LSK | |
Retrocopy | EEFD*LSNDLSK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 1 .75 RPM |
SRP012922_cerebellum | 0 .00 RPM | 48 .94 RPM |
SRP012922_heart | 0 .00 RPM | 1 .16 RPM |
SRP012922_kidney | 0 .00 RPM | 3 .56 RPM |
SRP012922_liver | 0 .00 RPM | 0 .77 RPM |
SRP012922_lung | 0 .00 RPM | 3 .67 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 0 .35 RPM |
SRP012922_spleen | 0 .00 RPM | 5 .84 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ciona intestinalis | ENSCING00000021790 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000010454 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000013387 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000016749 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000015229 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013336 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000006043 | 1 retrocopy |