RetrogeneDB ID: | retro_dnov_2181 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_53584:554..789(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SRP9 | ||
Ensembl ID: | ENSDNOG00000013412 | ||
Aliases: | None | ||
Description: | signal recognition particle 9kDa [Source:HGNC Symbol;Acc:11304] |
Percent Identity: | 77.78 % |
Parental protein coverage: | 91.86 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MPQYQTWEEFSRAAEKLYLADPMKA-RVVLKYRHSDGSLCIKVTDDLVCLVYRTDQAQDVKKIE-KFHSQ |
M.QYQTWEEF...A..LYL.DPMKA..VVLK..HSDGSLCIKVTDDLVCLVYRTD.AQDVKK...KF.SQ | |
Retrocopy | MSQYQTWEEFRYPAKRLYLTDPMKA<TVVLK*MHSDGSLCIKVTDDLVCLVYRTD*AQDVKKSK<KFYSQ |
Parental | LMRLMVAKESR |
LM.LMVAKES. | |
Retrocopy | LMGLMVAKESQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 35 .78 RPM |
SRP012922_cerebellum | 0 .00 RPM | 44 .26 RPM |
SRP012922_heart | 0 .00 RPM | 27 .84 RPM |
SRP012922_kidney | 0 .00 RPM | 24 .09 RPM |
SRP012922_liver | 0 .00 RPM | 42 .88 RPM |
SRP012922_lung | 0 .00 RPM | 43 .68 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 40 .50 RPM |
SRP012922_spleen | 0 .00 RPM | 29 .53 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000016162 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000013412 | 3 retrocopies |
retro_dnov_1947, retro_dnov_2181 , retro_dnov_742,
|
Echinops telfairi | ENSETEG00000012291 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000004081 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000001752 | 1 retrocopy |