RetrogeneDB ID: | retro_lafr_648 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
Coordinates: | scaffold_28:5403314..5403536(-) | ||
Located in intron of: | ENSLAFG00000002717 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SRP9 | ||
Ensembl ID: | ENSLAFG00000004081 | ||
Aliases: | None | ||
Description: | Signal recognition particle 9 kDa protein [Source:UniProtKB/TrEMBL;Acc:G3STL4] |
Percent Identity: | 81.08 % |
Parental protein coverage: | 86.05 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MPQFQTWEEFSRAAEKLYLADPMKARVVLKYRHTDGSLCIKVTDDLVCLVYRTDQAQDVKKIEKFHSQLM |
M.Q.Q.WE.FS.AAEKLYL..P.KA.VVLKYRHTDG.LCIKVTDD.VCLVYRT..AQDVKKI.KFHSQLM | |
Retrocopy | MLQYQAWEKFSMAAEKLYLTGPIKAPVVLKYRHTDGNLCIKVTDDSVCLVYRTNHAQDVKKIQKFHSQLM |
Parental | RLMV |
RLMV | |
Retrocopy | RLMV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000016162 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000013412 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000012291 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000004081 | 3 retrocopies |
retro_lafr_1184, retro_lafr_377, retro_lafr_648 ,
|
Otolemur garnettii | ENSOGAG00000001752 | 1 retrocopy |