RetrogeneDB ID: | retro_ecab_489 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 2:51392161..51392380(+) | ||
Located in intron of: | ENSECAG00000009540 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PCBD2 | ||
Ensembl ID: | ENSECAG00000015810 | ||
Aliases: | None | ||
Description: | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 [Source:HGNC Symbol;Acc:24474] |
Percent Identity: | 71.23 % |
Parental protein coverage: | 71.57 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | RDAIYKEFSFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTKRDVKLAKFIEKAA |
RDA.Y.EFSFKNFNQAFGF.S.V..QAEK..HHPE.FN...KVQIT.T.H..GG.TKR.VKL.KF.EKAA | |
Retrocopy | RDAMYREFSFKNFNQAFGFISQVTIQAEKIKHHPE*FNGHYKVQITFTLHVWGGVTKRNVKLVKFFEKAA |
Parental | ASV |
.SV | |
Retrocopy | VSV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 1 .30 RPM |
SRP021940_cerebellum | 0 .00 RPM | 2 .34 RPM |
SRP021940_embryo | 0 .10 RPM | 3 .73 RPM |
SRP021940_placental_villous | 0 .00 RPM | 2 .84 RPM |
SRP021940_synovial_membrane | 0 .05 RPM | 3 .24 RPM |
SRP021940_testis | 0 .00 RPM | 4 .73 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000019125 | 2 retrocopies | |
Equus caballus | ENSECAG00000015810 | 2 retrocopies |
retro_ecab_489 , retro_ecab_871,
|
Erinaceus europaeus | ENSEEUG00000007051 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000016658 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000003784 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000012638 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000014351 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000000384 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000016874 | 3 retrocopies |