RetrogeneDB ID: | retro_etel_1252 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_235532:1600..1815(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PCBD2 | ||
Ensembl ID: | ENSETEG00000016658 | ||
Aliases: | None | ||
Description: | pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2 [Source:HGNC Symbol;Acc:24474] |
Percent Identity: | 58.9 % |
Parental protein coverage: | 70.59 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | NAIYKEFLFKNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGGLTK-KDVKLAQFIEKAA |
NAIYK.F.F...NQ.F.FMS.V.LQ.EK.NHHPEWFN....V..TLTS...G.L...K...L.QFI.KA. | |
Retrocopy | NAIYKKFSF*KSNQVFRFMSQVGLQVEKTNHHPEWFNECSNVHVTLTSLAEGRLAR<KGLRLIQFIGKAV |
Parental | ASV |
ASV | |
Retrocopy | ASV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000019125 | 2 retrocopies | |
Equus caballus | ENSECAG00000015810 | 2 retrocopies | |
Erinaceus europaeus | ENSEEUG00000007051 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000016658 | 2 retrocopies |
retro_etel_1252 , retro_etel_75,
|
Macropus eugenii | ENSMEUG00000003784 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000012638 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000014351 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000000384 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000016874 | 3 retrocopies |