RetrogeneDB ID: | retro_eeur_220 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_212287:2012..2225(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ENY2 | ||
Ensembl ID: | ENSEEUG00000012383 | ||
Aliases: | None | ||
Description: | enhancer of yellow 2 homolog (Drosophila) [Source:HGNC Symbol;Acc:24449] |
Percent Identity: | 63.38 % |
Parental protein coverage: | 95.89 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | LLRAKLIECGWKDQLKAHCKEVIKEK-GLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHAS |
LLRA.LI..GWK..LK.H.KEVIKEK.....V.VD.LVAE.TPK...LVPDSVK...L.RI...LAQ.AS | |
Retrocopy | LLRAQLIKYGWKNRLKPHGKEVIKEKESIGYVNVDNLVAELTPKSVFLVPDSVKNNILRRINILLAQPAS |
Parental | L |
L | |
Retrocopy | L |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 14 .66 RPM |
SRP017611_kidney | 0 .00 RPM | 13 .69 RPM |
SRP017611_liver | 0 .00 RPM | 10 .61 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Anolis carolinensis | ENSACAG00000003039 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000007377 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000012383 | 3 retrocopies |
retro_eeur_125, retro_eeur_220 , retro_eeur_512,
|
Myotis lucifugus | ENSMLUG00000027585 | 1 retrocopy | |
Sorex araneus | ENSSARG00000009845 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000001787 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000001742 | 3 retrocopies |