RetrogeneDB ID: | retro_eeur_458 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | scaffold_312892:4773..5013(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | URM1 | ||
Ensembl ID: | ENSEEUG00000012945 | ||
Aliases: | None | ||
Description: | ubiquitin related modifier 1 [Source:HGNC Symbol;Acc:28378] |
Percent Identity: | 80. % |
Parental protein coverage: | 79.21 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | PLSVEVEFGGGAELLFDGIRKHQVTLPGQEEPWDIRNLLVWIKNNLLKEQPELFIQGDSVRPGILVLVND |
PL.V.VEF..G..LLFD.I.KHQVTLPGQE.PWD..NLLVWIK.NLLKE.PELFIQGDSVRPGILVL.ND | |
Retrocopy | PLPVKVEFESGEKLLFDDIKKHQVTLPGQE*PWDF*NLLVWIKKNLLKELPELFIQGDSVRPGILVLFND |
Parental | ADWELLGELD |
.DWELLGEL. | |
Retrocopy | LDWELLGELE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 9 .83 RPM |
SRP017611_kidney | 0 .00 RPM | 11 .06 RPM |
SRP017611_liver | 0 .00 RPM | 4 .02 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000025612 | 2 retrocopies | |
Erinaceus europaeus | ENSEEUG00000012945 | 1 retrocopy |
retro_eeur_458 ,
|
Loxodonta africana | ENSLAFG00000002178 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000014147 | 1 retrocopy |