RetrogeneDB ID: | retro_eeur_458 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_312892:4773..5013(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | URM1 | ||
| Ensembl ID: | ENSEEUG00000012945 | ||
| Aliases: | None | ||
| Description: | ubiquitin related modifier 1 [Source:HGNC Symbol;Acc:28378] |
| Percent Identity: | 80.0 % |
| Parental protein coverage: | 79.21 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | PLSVEVEFGGGAELLFDGIRKHQVTLPGQEEPWDIRNLLVWIKNNLLKEQPELFIQGDSVRPGILVLVND |
| PL.V.VEF..G..LLFD.I.KHQVTLPGQE.PWD..NLLVWIK.NLLKE.PELFIQGDSVRPGILVL.ND | |
| Retrocopy | PLPVKVEFESGEKLLFDDIKKHQVTLPGQE*PWDF*NLLVWIKKNLLKELPELFIQGDSVRPGILVLFND |
| Parental | ADWELLGELD |
| .DWELLGEL. | |
| Retrocopy | LDWELLGELE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 9 .83 RPM |
| SRP017611_kidney | 0 .00 RPM | 11 .06 RPM |
| SRP017611_liver | 0 .00 RPM | 4 .02 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000025612 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000012945 | 1 retrocopy |
retro_eeur_458 ,
|
| Loxodonta africana | ENSLAFG00000002178 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014147 | 1 retrocopy |