RetrogeneDB ID: | retro_eeur_634 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_371511:43738..43963(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SS18L2 | ||
| Ensembl ID: | ENSEEUG00000014065 | ||
| Aliases: | None | ||
| Description: | synovial sarcoma translocation gene on chromosome 18-like 2 [Source:HGNC Symbol;Acc:15593] |
| Percent Identity: | 85.33 % |
| Parental protein coverage: | 98.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSVAFVPDWMRGKAEVNQETIQRLLEENDQLIRCIVEYQNKGRAHECVQ-RQVLHRNLIYLASIADASPT |
| MSVAFV.DWMRGKAEVNQETIQRLLEENDQLI.CIV.YQNKGRAHECVQ..QVL.R.LI.LA..ADASPT | |
| Retrocopy | MSVAFVLDWMRGKAEVNQETIQRLLEENDQLICCIVKYQNKGRAHECVQYQQVLPRKLIFLATTADASPT |
| Parental | NTAKE |
| NTAK. | |
| Retrocopy | NTAKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 6 .28 RPM |
| SRP017611_kidney | 0 .00 RPM | 4 .88 RPM |
| SRP017611_liver | 0 .00 RPM | 3 .54 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000000989 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000015005 | 4 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000014065 | 1 retrocopy |
retro_eeur_634 ,
|
| Echinops telfairi | ENSETEG00000007192 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000021542 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000013024 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032526 | 3 retrocopies | |
| Ochotona princeps | ENSOPRG00000015198 | 4 retrocopies | |
| Sorex araneus | ENSSARG00000014056 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007658 | 1 retrocopy |