RetrogeneDB ID: | retro_etel_1471 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_271236:3367..3697(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SLIRP | ||
Ensembl ID: | ENSETEG00000010345 | ||
Aliases: | None | ||
Description: | SRA stem-loop interacting RNA binding protein [Source:HGNC Symbol;Acc:20495] |
Percent Identity: | 50.91 % |
Parental protein coverage: | 98.15 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | ASAARSAAALRTSLSRPIAFVRKVPWTAASGELKEHFAQFAQIRRCTLPFNRDTGFHKGMAWIVFSSAEE |
A...RS...L.T..S..IAFVR..P.T....EL.EH.AQF.Q..RCT...N.D..FH.GMA...FSS.EE | |
Retrocopy | AAVVRSTTSLHTHISQYIAFVRNIP*TTTLSELREHLAQFGQV*RCTVLLNKDAAFHRGMARSLFSSEEE |
Parental | LQNA-LQQENHIIDGVKLQVQAQRRKCSQ---TSDEEKDF |
LQ.A.......I.DGVKLQVQAQ.....Q...TS..EK.F | |
Retrocopy | LQKAFVTAGKYIVDGVKLQVQAQ*WEALQGDQTSNKEKHF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003975 | 3 retrocopies | |
Bos taurus | ENSBTAG00000008135 | 3 retrocopies | |
Canis familiaris | ENSCAFG00000017230 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016946 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000001500 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000007721 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000010345 | 4 retrocopies | |
Felis catus | ENSFCAG00000024050 | 2 retrocopies | |
Homo sapiens | ENSG00000119705 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000011059 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000012080 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000029256 | 1 retrocopy | |
Mus musculus | ENSMUSG00000021040 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006030 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000030691 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012314 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000028167 | 5 retrocopies | |
Tupaia belangeri | ENSTBEG00000013979 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000001781 | 2 retrocopies |