RetrogeneDB ID: | retro_etel_1505 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | scaffold_275712:6035..6218(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ACYP2 | ||
Ensembl ID: | ENSETEG00000017888 | ||
Aliases: | None | ||
Description: | acylphosphatase 2, muscle type [Source:HGNC Symbol;Acc:180] |
Percent Identity: | 83.61 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSANESLKWVAYEVLGNMQGVCFRMYTEGEAKKLGVVGWVKNTSKGTVTGQVQGPEEKVNS |
MS..ESLK.V.YEV..N.QGVCFRMYTEGEAKKLGVV..VKNTS.GTVTGQVQGPEEKVNS | |
Retrocopy | MSSKESLKSVDYEVFSNVQGVCFRMYTEGEAKKLGVVDCVKNTSRGTVTGQVQGPEEKVNS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000023070 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000017888 | 1 retrocopy |
retro_etel_1505 ,
|
Oryctolagus cuniculus | ENSOCUG00000015408 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000013671 | 1 retrocopy |