RetrogeneDB ID: | retro_fcat_1558 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | D3:65768642..65768860(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CCDC167 | ||
Ensembl ID: | ENSFCAG00000006745 | ||
Aliases: | None | ||
Description: | coiled-coil domain containing 167 [Source:HGNC Symbol;Acc:21239] |
Percent Identity: | 60.81 % |
Parental protein coverage: | 81.11 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | NLGCLQQIDGLEEKLSQCRKDLEAVNSRLCGTEL-SPETRKSLEKEKNSLMNKASNYEKELKLLRQENRK |
NLG............SQC...LEAVNSRL.G.........KSLEKEKNSLMNKASNYEK.LKLL.QEN.. | |
Retrocopy | NLGIALXXXXXXXXVSQCSRHLEAVNSRL*GRDK<TQMAKKSLEKEKNSLMNKASNYEKKLKLLQQENW* |
Parental | NMLL |
NMLL | |
Retrocopy | NMLL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 1 .61 RPM |
SRP017611_kidney | 0 .00 RPM | 2 .37 RPM |
SRP017611_liver | 0 .00 RPM | 5 .46 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000012069 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000030835 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000005622 | 2 retrocopies | |
Felis catus | ENSFCAG00000006745 | 1 retrocopy |
retro_fcat_1558 ,
|
Mus musculus | ENSMUSG00000024018 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000000921 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016563 | 1 retrocopy |