RetrogeneDB ID: | retro_fcat_1987 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | X:53133056..53133275(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ZNRF2 | ||
Ensembl ID: | ENSFCAG00000026521 | ||
Aliases: | None | ||
Description: | zinc and ring finger 2 [Source:HGNC Symbol;Acc:22316] |
Percent Identity: | 59.49 % |
Parental protein coverage: | 81.72 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | VPSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICL-EELQ-QGDTIARLPCLCIY-HKGCIDEWFEVN |
VPS.EM..H.VMC..KPR...NEDVLSKDAG.CA.CL.E..Q..G.TIA.LP..C...H......WF..N | |
Retrocopy | VPSHEMGMHDVMC*RKPRLSHNEDVLSKDAGQCAVCL<EKMQ<EGGTIAGLP--CLF<HISLRLHWFKIN |
Parental | RSCPEHPSD |
RSCPEH.SD | |
Retrocopy | RSCPEHLSD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 3 .44 RPM |
SRP017611_kidney | 0 .00 RPM | 14 .33 RPM |
SRP017611_liver | 0 .00 RPM | 5 .86 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000027612 | 1 retrocopy | |
Felis catus | ENSFCAG00000026521 | 1 retrocopy |
retro_fcat_1987 ,
|