RetrogeneDB ID: | retro_fcat_478 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
Coordinates: | A3:69297338..69297549(-) | ||
Located in intron of: | ENSFCAG00000013448 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LAMTOR5 | ||
Ensembl ID: | ENSFCAG00000023792 | ||
Aliases: | None | ||
Description: | late endosomal/lysosomal adaptor, MAPK and MTOR activator 5 [Source:HGNC Symbol;Acc:17955] |
Percent Identity: | 83.56 % |
Parental protein coverage: | 78.02 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | VLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAA-KLTSDPTDIPVVCLESDNGNIMIQKHDSITVAV-HK |
VLCT.SQGLNLGC.GTLSDEHAGV.S.LAQQ.A..LTSDPTD.PVV.LESDNGNIMIQK.D.ITVAV.HK | |
Retrocopy | VLCTGSQGLNLGCHGTLSDEHAGVLSILAQQVA<ELTSDPTDTPVVRLESDNGNIMIQKQDRITVAV<HK |
Parental | MAS |
MAS | |
Retrocopy | MAS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 15 .84 RPM |
SRP017611_kidney | 0 .00 RPM | 31 .43 RPM |
SRP017611_liver | 0 .00 RPM | 11 .42 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011504 | 2 retrocopies | |
Bos taurus | ENSBTAG00000014970 | 3 retrocopies | |
Felis catus | ENSFCAG00000023792 | 5 retrocopies | |
Macaca mulatta | ENSMMUG00000015023 | 4 retrocopies | |
Sus scrofa | ENSSSCG00000006807 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003401 | 5 retrocopies |