RetrogeneDB ID: | retro_itri_1118 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393379.1:1200547..1200879(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MCFD2 | ||
Ensembl ID: | ENSSTOG00000003692 | ||
Aliases: | None | ||
Description: | multiple coagulation factor deficiency 2 [Source:HGNC Symbol;Acc:18451] |
Percent Identity: | 81.74 % |
Parental protein coverage: | 78.08 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | VPHPSSVGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQHHYFKIHDYDGNNLLDGLELSTAITHVHK |
.P..SS.G.DKN.VHDQEHIMEHLEGVINKP.AEMSPQELQHHYFKIHDYDGNNLLDGLELS.AI..... | |
Retrocopy | MPGLSSLGFDKNMVHDQEHIMEHLEGVINKP*AEMSPQELQHHYFKIHDYDGNNLLDGLELSRAIMSIWR |
Parental | -EEESEQAPLMSEEELINIIDGVLRDDDKNNDGYIDYAEFAKSLQ |
.EE.SEQ.PLMS..ELI.IIDGVLR.DDKNNDGYID.AEFAKSLQ | |
Retrocopy | <EE-SEQVPLMS-KELIYIIDGVLR-DDKNNDGYID*AEFAKSLQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006097 | 2 retrocopies | |
Bos taurus | ENSBTAG00000003358 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000032480 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000003286 | 6 retrocopies | |
Felis catus | ENSFCAG00000009220 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000010002 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000004210 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000012043 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000021325 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000003692 | 1 retrocopy |
retro_itri_1118 ,
|
Vicugna pacos | ENSVPAG00000010692 | 1 retrocopy |