RetrogeneDB ID: | retro_itri_1624 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393579.1:1498061..1498298(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | VHL | ||
Ensembl ID: | ENSSTOG00000013959 | ||
Aliases: | None | ||
Description: | von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:12687] |
Percent Identity: | 58.02 % |
Parental protein coverage: | 50.31 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | YPTLPPGTGRRIHSYRGHLWLFRDAGTYDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVR |
..T..PG....IHSYR.HLWLFRDAGT.DGLLVN.TELFVPSLNVDGQPIF....L......ER...... | |
Retrocopy | HQTVLPGRNLSIHSYRDHLWLFRDAGTDDGLLVNLTELFVPSLNVDGQPIFLPASLWPCVYPERAMPA-- |
Parental | SLVKPENYRRL |
...KP...R.L | |
Retrocopy | GCAKPSQAREL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Gorilla gorilla | ENSGGOG00000010456 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000007587 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000013663 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000013959 | 1 retrocopy |
retro_itri_1624 ,
|