RetrogeneDB ID: | retro_itri_900 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
Coordinates: | JH393340.1:933963..934187(-) | ||
Located in intron of: | ENSSTOG00000001120 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2V2 | ||
Ensembl ID: | ENSSTOG00000021769 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2 variant 2 [Source:HGNC Symbol;Acc:12495] |
Percent Identity: | 51.28 % |
Parental protein coverage: | 52.41 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | LEDDEDMTLTRWTGMIIGPPRTNYENRIYSL-KVECGPKYPEAPPS-VRFVTKINMNGINNSSGMVDARS |
LE.DE..T..RWTG...G.PRT.YE...Y.L.K........EA.PS..R.V..IN....NNSSG.V.ARS | |
Retrocopy | LEEDEHETPKRWTGVMTGTPRTDYEDKRYKLLKQDVNTEHSEA-PS<LRSVIWIN-KPLNNSSGTVGARS |
Parental | IPVLAKWQ |
.P.L.KWQ | |
Retrocopy | TPELVKWQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000023218 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000016581 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000010191 | 10 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006933 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000018575 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000014322 | 6 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000021769 | 2 retrocopies |
retro_itri_568, retro_itri_900 ,
|