RetrogeneDB ID: | retro_mdom_1363 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 4:147285901..147286075(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GPX4 | ||
| Ensembl ID: | ENSMODG00000005486 | ||
| Aliases: | None | ||
| Description: | glutathione peroxidase 4 [Source:HGNC Symbol;Acc:4556] |
| Percent Identity: | 67.24 % |
| Parental protein coverage: | 84.06 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | VNGDDAHPLWKWMKIQPRGKGILGNAIKWNFTKFLIDKDGCVVKRYGPMEEPQVIEKD |
| VNG...HPLWKW.KIQP..KGILGN..KWNF..FLIDKD...VK..GP.E.P.VIEK. | |
| Retrocopy | VNGYNVHPLWKWIKIQPKRKGILGNVLKWNFINFLIDKDDFMVKL*GPVE*PLVIEKN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Felis catus | ENSFCAG00000022744 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000005486 | 1 retrocopy |
retro_mdom_1363 ,
|
| Mus musculus | ENSMUSG00000075706 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000008347 | 4 retrocopies |