RetrogeneDB ID: | retro_mdom_1600 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 6:123453292..123453708(+) | ||
| Located in intron of: | ENSMODG00000007685 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDFIP2 | ||
| Ensembl ID: | ENSMODG00000001586 | ||
| Aliases: | None | ||
| Description: | Nedd4 family interacting protein 2 [Source:HGNC Symbol;Acc:18537] |
| Percent Identity: | 50.68 % |
| Parental protein coverage: | 59.66 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 3 |
| Parental | HKPMTTRRYQVLHNEDDNSELPVVEPPSTST-QIPQTSPSAPILEPETSPPPYSS-ITVEAAATSEPETH |
| HK..T...YQVLH.E..NSE.P..E.P.T......Q.SPSAPILEP........S....EA.ATSE.ET. | |
| Retrocopy | HKLITSCHYQVLHKEY-NSESPAPE-PLTPS<NTAQASPSAPILEPNVFLLYFKSSMNKEATATSERETE |
| Parental | SEFYPVPPPYSVATSLPTYDEAEKAKAAAMAAAAAEPSL-REEEFPPRDDFSDADQLRVGNDG-IFMLAF |
| S......P..S...S.....EA.KAK.AAMAAA.A...L.R...FPP..DFSDAD.LRVG....IFML.. | |
| Retrocopy | SFILCCQPYISFLSSKD--EEARKAKTAAMAAATAGALL<RKKDFPPKTDFSDAD*LRVGDHF>IFMLVL |
| Parental | FMAFIF |
| FM..IF | |
| Retrocopy | FMELIF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000021282 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000014687 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000864 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000001586 | 2 retrocopies |
retro_mdom_1600 , retro_mdom_48,
|
| Mustela putorius furo | ENSMPUG00000003366 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005780 | 1 retrocopy |