RetrogeneDB ID: | retro_meug_467 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | Scaffold11909:2695..2926(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA4L2 | ||
Ensembl ID: | ENSMEUG00000014358 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 [Source:HGNC Symbol;Acc:29836] |
Percent Identity: | 54.55 % |
Parental protein coverage: | 88.51 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | IRQIKKNPGLIPLISFIGLGMGSAALYLLRLALRSPDVSWDRKNNPEPWNRLSPNDQYKFLAVSMDYKKL |
I.Q.KK...LI.L..FIG.G.....LY...LAL..PD.SW.RKNNPEPWN...P..Q.KF..V..DY.KL | |
Retrocopy | INQAKKH*SLILLFVFIGVGGTRVTLYVMCLALFNPDISWNRKNNPEPWNKMNPTNQNKFYSVNVDYSKL |
Parental | KKDRPDF |
KK..P.F | |
Retrocopy | KKKGPGF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Echinops telfairi | ENSETEG00000004466 | 1 retrocopy | |
Homo sapiens | ENSG00000185633 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000021950 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000014358 | 3 retrocopies |
retro_meug_1159, retro_meug_1559, retro_meug_467 ,
|
Nomascus leucogenys | ENSNLEG00000017371 | 10 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000020476 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015731 | 5 retrocopies |