RetrogeneDB ID: | retro_meug_905 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | Scaffold2262:47806..48007(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GABARAPL3 | ||
Ensembl ID: | ENSMEUG00000002873 | ||
Aliases: | None | ||
Description: | GABA(A) receptors associated protein like 3, pseudogene [Source:HGNC Symbol;Acc:4069] |
Percent Identity: | 65.22 % |
Parental protein coverage: | 58.97 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIH |
MK...K..HPF....KEG.KI..KYPD.VPVIVEKAP..RVPDLDK..YL.PSDLTVG...FLI.K..H | |
Retrocopy | MKL*HKQGHPF*CWTKEGKKIWNKYPDKVPVIVEKAPNTRVPDLDKWEYLMPSDLTVG--WFLIQKWTH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Equus caballus | ENSECAG00000014832 | 1 retrocopy | |
Homo sapiens | ENSG00000139112 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000022360 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000002873 | 3 retrocopies |
retro_meug_1584, retro_meug_1840, retro_meug_905 ,
|
Sarcophilus harrisii | ENSSHAG00000007434 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000002246 | 1 retrocopy |