RetrogeneDB ID: | retro_mluc_1927 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429953:2103626..2103871(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | COMMD6 | ||
| Ensembl ID: | ENSMLUG00000010697 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.29 % |
| Parental protein coverage: | 96.47 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | GSNEPVLDAKAKVTNQLVDFQWKLGMAVS-SDSCRSLKYPYVAVMLKVADHSGQVKTKSFEMTIPQFQNF |
| G.....LDAKA.VT.QLV.F.WKLG.A...SDSCRS.KYPY.AVM.KVADHSGQV..KSF.MTI.QFQNF | |
| Retrocopy | GVQQSLLDAKADVTHQLVCFLWKLGVAGA<SDSCRSVKYPYGAVMRKVADHSGQVQNKSFGMTILQFQNF |
| Parental | YRQFKEIAAIIET |
| .RQ.KEIA.IIET | |
| Retrocopy | HRQSKEIASIIET |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000011048 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000006061 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010697 | 1 retrocopy |
retro_mluc_1927 ,
|
| Monodelphis domestica | ENSMODG00000000970 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026952 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000038012 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003379 | 2 retrocopies |