RetrogeneDB ID: | retro_mluc_602 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
Coordinates: | GL429769:17783130..17783313(+) | ||
Located in intron of: | ENSMLUG00000009240 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PPP1R14B | ||
Ensembl ID: | ENSMLUG00000022952 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 83.61 % |
Parental protein coverage: | 84.72 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | EEEIPELEIDVDELLDMESDDTRAARVKELLVDCYKPTEAFISGLLDKIRGMQKLSTPQKK |
.E.I..LEIDVDELLDMESDDT.A.RVKELL.DCYKPTEAFISGLLDK..GMQKLST.QKK | |
Retrocopy | QEDILGLEIDVDELLDMESDDTQASRVKELLFDCYKPTEAFISGLLDKTGGMQKLSTYQKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Myotis lucifugus | ENSMLUG00000022952 | 3 retrocopies |
retro_mluc_466, retro_mluc_602 , retro_mluc_742,
|
Myotis lucifugus | ENSMLUG00000023245 | 2 retrocopies |