RetrogeneDB ID: | retro_mmul_1135 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 15:13537643..13538051(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.2378 | ||
Ensembl ID: | ENSMMUG00000019919 | ||
Aliases: | None | ||
Description: | proteasome subunit beta type-1 [Source:RefSeq peptide;Acc:NP_001247565] |
Percent Identity: | 63.12 % |
Parental protein coverage: | 56.02 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | SVAMYSAPGRDLG---MEPHGAAGPLQLRFSPYAFNGGTVLAIAGEDFAIVASDTRLSEGF-SIHTRDSP |
..A....P...LG....E....AG.L.L..S.Y.FNG.T.LA.A..DF.I..SDT.LS.GF.SI.T.D.P | |
Retrocopy | AAAVHCGPPQPLGSLTVELLSPAGSLGLYVSSYVFNGDTGLATAAQDFCIATSDTLLSQGF<SINTWDNP |
Parental | KCYKLTDKTVIGCSGFHGDCL-TLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILY-SRRFFPYYVYNI |
KCYKLTDKTVIGCSGFHGDCL..LTKII.A.LKMYKH.NNKAMTTGAI..ML.TILY.SR...PY..YNI | |
Retrocopy | KCYKLTDKTVIGCSGFHGDCL<SLTKIIAAKLKMYKHPNNKAMTTGAI-GMLFTILY<SRHYCPYDGYNI |
Parental | I |
. | |
Retrocopy | V |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 47 .29 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 61 .80 RPM |
SRP007412_cerebellum | 0 .00 RPM | 32 .93 RPM |
SRP007412_heart | 0 .00 RPM | 36 .16 RPM |
SRP007412_kidney | 0 .12 RPM | 59 .39 RPM |
SRP007412_liver | 0 .08 RPM | 77 .07 RPM |
SRP007412_testis | 0 .00 RPM | 42 .29 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017047 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000004116 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000020644 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000019502 | 1 retrocopy | |
Felis catus | ENSFCAG00000031269 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000022128 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000007469 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000019919 | 1 retrocopy |
retro_mmul_1135 ,
|
Mustela putorius furo | ENSMPUG00000007150 | 1 retrocopy | |
Mus musculus | ENSMUSG00000014769 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000007973 | 2 retrocopies | |
Procavia capensis | ENSPCAG00000000344 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000017191 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000006517 | 1 retrocopy |