RetrogeneDB ID: | retro_mmul_1524 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 2:96852228..96852665(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NFU1 | ||
Ensembl ID: | ENSMMUG00000000435 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 63.76 % |
Parental protein coverage: | 58.04 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | QPLHQFVQRPLFPLPAAFCNPGRFIFIM-NNQTLGPNFLKKIPSLPHTDTRTFSFYLNISLLRIYLRVFV |
QPLHQFV.R.LFPLPAAFCNP.R..FI..N.....PN.LK.IP..P...TR...F..........L.... | |
Retrocopy | QPLHQFVERLLFPLPAAFCNPVRHMFIQ<NTDIPNPNSLKFIPWKPVFETRLMDFPTPAAAFHSPLARQL |
Parental | FRRIEGVKSVFFGPDFITVTKENEDLDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGKEKRRENVYM |
FR.IEGVKSVFFGPDF.TVTKENE.LDWNLLKPDIY.T.MDFFASGLPLVTEET.SGEAG.E...E.V.M | |
Retrocopy | FR-IEGVKSVFFGPDFFTVTKENEKLDWNLLKPDIYTTTMDFFASGLPLVTEETSSGEAGYED-DEVVAM |
Parental | LKKILVSKI |
.K..L...I | |
Retrocopy | IKEVLDTRI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 1 .01 RPM | 9 .41 RPM |
SRP007412_brain_prefrontal_cortex | 0 .48 RPM | 4 .20 RPM |
SRP007412_cerebellum | 1 .16 RPM | 8 .72 RPM |
SRP007412_heart | 1 .12 RPM | 13 .07 RPM |
SRP007412_kidney | 1 .41 RPM | 12 .68 RPM |
SRP007412_liver | 0 .24 RPM | 3 .44 RPM |
SRP007412_testis | 2 .56 RPM | 17 .30 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2638 |
Pan troglodytes | retro_ptro_1778 |
Pongo abelii | retro_pabe_2329 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000005978 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000019156 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000019002 | 1 retrocopy | |
Homo sapiens | ENSG00000169599 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000000435 | 1 retrocopy |
retro_mmul_1524 ,
|
Monodelphis domestica | ENSMODG00000011805 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000006663 | 1 retrocopy | |
Mus musculus | ENSMUSG00000029993 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000010101 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000016760 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000012339 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000012016 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000008616 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013765 | 1 retrocopy |