RetrogeneDB ID: | retro_mmul_1650 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 3:179982440..179982749(+) | ||
Located in intron of: | ENSMMUG00000011188 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ARPC5L | ||
Ensembl ID: | ENSMMUG00000020628 | ||
Aliases: | None | ||
Description: | Actin-related protein 2/3 complex subunit 5 [Source:UniProtKB/TrEMBL;Acc:F7BM58] |
Percent Identity: | 71.84 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | GDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPT |
G.M..A..AAL.N.P.NTK.QAVK.RA...VLKVL..FK...IE.AVQSLD.NGVDLLMK.IYKGF..P. | |
Retrocopy | GNMTAALQAALKNLPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKCIYKGFGSPS |
Parental | ENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV |
.NSSAVLLQWHEK.LA.GG.GSI.RVLTARKTV | |
Retrocopy | DNSSAVLLQWHEKSLAAGGVGSIVRVLTARKTV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 3 .14 RPM | 43 .48 RPM |
SRP007412_brain_prefrontal_cortex | 5 .39 RPM | 44 .82 RPM |
SRP007412_cerebellum | 1 .61 RPM | 23 .44 RPM |
SRP007412_heart | 2 .30 RPM | 22 .67 RPM |
SRP007412_kidney | 4 .11 RPM | 16 .55 RPM |
SRP007412_liver | 3 .76 RPM | 9 .46 RPM |
SRP007412_testis | 1 .77 RPM | 119 .94 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000016540 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000006730 | 4 retrocopies | |
Felis catus | ENSFCAG00000028753 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020628 | 2 retrocopies |
retro_mmul_1650 , retro_mmul_623,
|
Mustela putorius furo | ENSMPUG00000013924 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000002997 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000013936 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021362 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000014317 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000007907 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000008398 | 1 retrocopy |