RetrogeneDB ID: | retro_mmul_2365 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 8:106075495..106075792(-) | ||
Located in intron of: | ENSMMUG00000019407 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MED21 | ||
Ensembl ID: | ENSMMUG00000003218 | ||
Aliases: | None | ||
Description: | mediator of RNA polymerase II transcription subunit 21 [Source:RefSeq peptide;Acc:NP_001245049] |
Percent Identity: | 81. % |
Parental protein coverage: | 69.44 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | DRLTQLQDAVNSLADQFCNAIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAALIARTAKDIDVL |
D.L.QL.D..NSL.DQFCNA..VLQQCG.PASF.NIQTAINKDQPANPTEEYAQL..ALIA.TAKDIDVL | |
Retrocopy | DQLMQL*DTMNSLSDQFCNATDVLQQCGLPASFNNIQTAINKDQPANPTEEYAQLLTALIAQTAKDIDVL |
Parental | IDSLPSEESTAALQAASLYKLEEENHEAAT |
IDSL.SEESTAAL.A.SLYKL...NHEAAT | |
Retrocopy | IDSLSSEESTAAL*ATSLYKL-Q*NHEAAT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 18 .71 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 14 .04 RPM |
SRP007412_cerebellum | 0 .06 RPM | 21 .37 RPM |
SRP007412_heart | 0 .00 RPM | 16 .49 RPM |
SRP007412_kidney | 0 .00 RPM | 22 .65 RPM |
SRP007412_liver | 0 .00 RPM | 6 .14 RPM |
SRP007412_testis | 0 .00 RPM | 39 .58 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4105 |
Pan troglodytes | retro_ptro_2786 |
Gorilla gorilla | retro_ggor_2756 |
Pongo abelii | retro_pabe_3361 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011670 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000010041 | 1 retrocopy | |
Homo sapiens | ENSG00000152944 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016313 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000007678 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000003218 | 1 retrocopy |
retro_mmul_2365 ,
|
Pongo abelii | ENSPPYG00000004377 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000004785 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000013357 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008391 | 2 retrocopies |