RetrogeneDB ID: | retro_dnov_998 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_13238:86140..86497(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MED21 | ||
Ensembl ID: | ENSDNOG00000010041 | ||
Aliases: | None | ||
Description: | mediator complex subunit 21 [Source:HGNC Symbol;Acc:11473] |
Percent Identity: | 76.47 % |
Parental protein coverage: | 82.64 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | AIGVLQQCGPPASFSNIQTAINKDQPANPTEEYAQLFAALIARTAKXXXXXXXXXXXXXXXXXXXAASLY |
A.GVLQQCGPPASFSNIQTAINKDQP.NPTEEYAQLFAA.IA.TAK...................AASLY | |
Retrocopy | ADGVLQQCGPPASFSNIQTAINKDQPGNPTEEYAQLFAAQIAQTAKDFDVLIDSLSSEESTAALQAASLY |
Parental | KLEEENHEAATCLEDVVYRGDMLLEKIQSALADIAQSQLKTRSGTHSQS |
KLEEENHE.ATCLEDVVYRGDMLLEKIQ.ALADI.QS.LKTRS.THSQS | |
Retrocopy | KLEEENHETATCLEDVVYRGDMLLEKIQRALADIEQS*LKTRSSTHSQS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 1 .36 RPM | 12 .83 RPM |
SRP012922_cerebellum | 2 .61 RPM | 18 .97 RPM |
SRP012922_heart | 1 .62 RPM | 23 .90 RPM |
SRP012922_kidney | 1 .64 RPM | 13 .69 RPM |
SRP012922_liver | 1 .86 RPM | 9 .13 RPM |
SRP012922_lung | 2 .29 RPM | 16 .34 RPM |
SRP012922_quadricep_muscle | 3 .29 RPM | 25 .27 RPM |
SRP012922_spleen | 3 .66 RPM | 24 .15 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000011670 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000010041 | 1 retrocopy |
retro_dnov_998 ,
|
Echinops telfairi | ENSETEG00000006223 | 1 retrocopy | |
Felis catus | ENSFCAG00000030691 | 1 retrocopy | |
Homo sapiens | ENSG00000152944 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016313 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000007678 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000003218 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005431 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004377 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000004785 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000013357 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008391 | 2 retrocopies |