RetrogeneDB ID: | retro_mmur_621 | ||
Retrocopylocation | Organism: | Mouse Lemur (Microcebus murinus) | |
Coordinates: | GeneScaffold_4240:147578..147973(-) | ||
Located in intron of: | ENSMICG00000010744 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FABP3 | ||
Ensembl ID: | ENSMICG00000009359 | ||
Aliases: | None | ||
Description: | fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor) [Source:HGNC Symbol;Acc:3557] |
Percent Identity: | 53.38 % |
Parental protein coverage: | 98.5 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | MVDAFLGTWKLVDSKNFDDYMKSIGVGFATRQVANMTKPTTIIEKNGD-TIILKTQSTFKNTEISFKLGV |
MV..F...W.L.D...FD..MK..G.GFATRQ..N.TKPT.II...GD......TQS.FKNT...F.L.. | |
Retrocopy | MVEDFCAIWELMDNQKFDECMKALGMGFATRQMENVTKPTVIITQEGD>KMVVRTQSIFKNTAMNFQLAE |
Parental | EFDETTADDRKVKSTVTLDGGK-LVHVQKWNGQETTLVRELSDGKLILTLTHGSVVCTRTYEK |
EFDETTA.DR..KS.V.LDG.K.L.HVQKW...ET..VRE...G....T.T.G.VV....YEK | |
Retrocopy | EFDETTAGDRNCKSAVSLDGDK>LFHVQKWDD*ETNFVREIKHGRIVMTFTFGDVVAVCHYEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000016819 | 2 retrocopies | |
Danio rerio | ENSDARG00000023290 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000000511 | 2 retrocopies | |
Equus caballus | ENSECAG00000024852 | 1 retrocopy | |
Homo sapiens | ENSG00000121769 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000014432 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000012501 | 6 retrocopies | |
Microcebus murinus | ENSMICG00000001311 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000005319 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000009359 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000013609 | 2 retrocopies | |
Mus musculus | ENSMUSG00000028773 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000001586 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013757 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000001616 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000000457 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012879 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003842 | 3 retrocopies |