RetrogeneDB ID: | retro_mmus_65 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 10:86731986..86732388(-) | ||
Located in intron of: | ENSMUSG00000044937 | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000056366 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Fabp3 | ||
Ensembl ID: | ENSMUSG00000028773 | ||
Aliases: | None | ||
Description: | fatty acid binding protein 3, muscle and heart [Source:MGI Symbol;Acc:MGI:95476] |
Percent Identity: | 98.5 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIE |
MADAFVGTWKLVD.KNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIE | |
Retrocopy | MADAFVGTWKLVDCKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIE |
Parental | FDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTHGSVVSTRTYEKEA |
FDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVD.KLILTLTHGSVVSTRTYEKEA | |
Retrocopy | FDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDRKLILTLTHGSVVSTRTYEKEA |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .21 RPM | 17 .38 RPM |
SRP007412_cerebellum | 0 .17 RPM | 14 .24 RPM |
SRP007412_heart | 11 .05 RPM | 1238 .89 RPM |
SRP007412_kidney | 1 .58 RPM | 279 .45 RPM |
SRP007412_liver | 0 .03 RPM | 0 .05 RPM |
SRP007412_testis | 0 .87 RPM | 24 .79 RPM |
TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
---|---|---|---|---|---|---|
no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
TSS #1 | TSS_6858 | 867 libraries | 142 libraries | 55 libraries | 1 library | 7 libraries |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000016819 | 2 retrocopies | |
Danio rerio | ENSDARG00000023290 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000000511 | 2 retrocopies | |
Equus caballus | ENSECAG00000024852 | 1 retrocopy | |
Homo sapiens | ENSG00000121769 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000014432 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000012501 | 6 retrocopies | |
Microcebus murinus | ENSMICG00000009359 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000013609 | 2 retrocopies | |
Mus musculus | ENSMUSG00000027533 | 4 retrocopies | |
Mus musculus | ENSMUSG00000028773 | 3 retrocopies |
retro_mmus_2804, retro_mmus_3204, retro_mmus_65 ,
|
Nomascus leucogenys | ENSNLEG00000001586 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000013757 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000001616 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000000457 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000012879 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003842 | 3 retrocopies |