RetrogeneDB ID: | retro_mmus_1696 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 18:15011245..15011689(+) | ||
| Located in intron of: | ENSMUSG00000036225 | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000071867 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Mrpl27 | ||
| Ensembl ID: | ENSMUSG00000024414 | ||
| Aliases: | Mrpl27, A630055F16Rik, D11Moh47, D18Ertd643e | ||
| Description: | mitochondrial ribosomal protein L27 [Source:MGI Symbol;Acc:MGI:2137224] |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAAAALTLRTRAAVTALLSPTAPTALAVRHASKKTGGSSKNLGGKSRGKHYGIKKMEGHYVHAGNILGTQ |
| MAAAALTLRTRAAVTALLSPTAPTALAVRHASKKTGGSSKNLGGKSRGKHYGIKKMEGHYVHAGNILGTQ | |
| Retrocopy | MAAAALTLRTRAAVTALLSPTAPTALAVRHASKKTGGSSKNLGGKSRGKHYGIKKMEGHYVHAGNILGTQ |
| Parental | RQFRWHPGAHVGLGRNKCLYALEEGIVRYTKDVYVPNPKNTEAVDLVTSLPKGAVLYKTFVHVVPAKPEG |
| RQFRWHPGAHVGLGRNKCLYALEEGIVRYTKDVYVPNPKNTEAVDLVTSLPKGAVLYKTFVHVVPAKPEG | |
| Retrocopy | RQFRWHPGAHVGLGRNKCLYALEEGIVRYTKDVYVPNPKNTEAVDLVTSLPKGAVLYKTFVHVVPAKPEG |
| Parental | TFKLVDML |
| TFKLVDML | |
| Retrocopy | TFKLVDML |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 16 .28 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 10 .90 RPM |
| SRP007412_heart | 0 .09 RPM | 14 .94 RPM |
| SRP007412_kidney | 0 .10 RPM | 17 .86 RPM |
| SRP007412_liver | 0 .14 RPM | 20 .51 RPM |
| SRP007412_testis | 0 .00 RPM | 3 .93 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_57945 | 537 libraries | 445 libraries | 87 libraries | 2 libraries | 1 library |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000017031 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000005103 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000018851 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000023845 | 2 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000010549 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000014252 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000009698 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017231 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024414 | 2 retrocopies |
retro_mmus_1696 , retro_mmus_2918,
|
| Oryctolagus cuniculus | ENSOCUG00000004601 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000005385 | 1 retrocopy |