RetrogeneDB ID: | retro_mmus_2226 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 3:14384085..14384411(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Csrp1 | ||
Ensembl ID: | ENSMUSG00000026421 | ||
Aliases: | Csrp1, AA408841, AA959891, AW545626, CRP1, Csrp | ||
Description: | cysteine and glycine-rich protein 1 [Source:MGI Symbol;Acc:MGI:88549] |
Percent Identity: | 79.09 % |
Parental protein coverage: | 56.48 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | MPNW-GGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPK |
MPNW.GG.KKC.VCQKTVYFAEEVQ.EGNSFHKSCFLCM.CKKNLDSTTVAVHG.E.Y.KSCY.KK..PK | |
Retrocopy | MPNW<GGSKKCMVCQKTVYFAEEVQ*EGNSFHKSCFLCMICKKNLDSTTVAVHGKESYFKSCYSKK*EPK |
Parental | GYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKF |
..G...G.GTLSTDK.E.LGIK..EAPG.RPTTNP.ASKF | |
Retrocopy | N*GNRRGTGTLSTDKDECLGIKPQEAPGYRPTTNPEASKF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 168 .77 RPM |
SRP007412_cerebellum | 0 .00 RPM | 176 .12 RPM |
SRP007412_heart | 0 .00 RPM | 51 .49 RPM |
SRP007412_kidney | 0 .00 RPM | 73 .78 RPM |
SRP007412_liver | 0 .00 RPM | 15 .98 RPM |
SRP007412_testis | 0 .00 RPM | 18 .62 RPM |
TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
---|---|---|---|---|---|---|
no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
TSS #1 | TSS_93071 | 172 libraries | 179 libraries | 638 libraries | 78 libraries | 5 libraries |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000012114 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000017067 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020772 | 1 retrocopy | |
Mus musculus | ENSMUSG00000026421 | 1 retrocopy |
retro_mmus_2226 ,
|
Pan troglodytes | ENSPTRG00000001836 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000008991 | 1 retrocopy | |
Drosophila melanogaster | FBgn0259209 | 1 retrocopy |