RetrogeneDB ID: | retro_mputfur_1569 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL897261.1:533617..533854(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMPUG00000010789 | ||
| Aliases: | None | ||
| Description: | None |
Retrocopy-Parental alignment summary:
>retro_mputfur_1569
AACACAACACCAGGCAAGGTAGGAACAAGGCAAGATTTATTAAAGGCACTCTCCTGCGAAGGCGAAGTTTCAGGGCTCAG
AAGAAGGGGAGACAGGAAAGTCACACTGGGAGGAGGTGGGCACTCTCTGGCGACATTTGAGGTTCGGTGACTCCAGAGTG
GGGAGTCAGTGAGTCAGCGAAGTTGCGCTGGGAGGGAGTCGCCCAGGGTCTTCTATCTGGCTAAGGCAGGGCATGGG
ORF - retro_mputfur_1569 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: | 55.7 % |
| Parental protein coverage: | 73.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
Retrocopy - Parental Gene Alignment:
| Parental | NTTPGEVGTRQDLLKALS--GDVSGLRRREARKVALGGGQHS-RSFEDEHLRGSEC---QGTAGVKGFYL |
| NTTPG.VGTRQDLLKALS..G.VSGLRRR..RKV.LGGG.HS...FE...L...E.......AG...... | |
| Retrocopy | NTTPGKVGTRQDLLKALSCEGEVSGLRRRGDRKVTLGGGGHSLATFEVR*LQSGESVSQRSCAGRESPRV |
| Parental | FIGERAGAG |
| F....AG.G | |
| Retrocopy | FYLAKAGHG |
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
Mustela putorius furo was not studied using RNA-Seq expression data.
Mustela putorius furo was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_mputfur_1569 retrocopy.
Mustela putorius furo was not studied using FANTOM5 data.
retro_mputfur_1569 was not experimentally validated.
Retrocopy orthology:
Mustela putorius furo does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to help section.Parental genes homology:
Parental genes homology involve 1 parental gene, and 3 retrocopies.| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Mustela putorius furo | ENSMPUG00000010789 | 3 retrocopies |
retro_mputfur_1520, retro_mputfur_1552, retro_mputfur_1569 ,
|