RetrogeneDB ID: | retro_ocun_993 | ||
Retrocopylocation | Organism: | Rabbit (Oryctolagus cuniculus) | |
Coordinates: | 18:42185584..42185815(-) | ||
Located in intron of: | ENSOCUG00000007483 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MTPN | ||
Ensembl ID: | ENSOCUG00000005642 | ||
Aliases: | None | ||
Description: | myotrophin [Source:HGNC Symbol;Acc:15667] |
Percent Identity: | 57.14 % |
Parental protein coverage: | 65.25 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHIT |
MC.KE..W.L.NGDLDE.K.Y..KGED.N.TLEG.R.PL.....C.Q.EI..FLLLKGADIN.P...... | |
Retrocopy | MCNKECIWGLQNGDLDEMKYYMSKGEDLNQTLEGRRRPLYCVPNCRQFEIPAFLLLKGADINSPANTLLP |
Parental | PLLSAVY |
...S.VY | |
Retrocopy | YYSSSVY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 33 .78 RPM |
SRP017611_kidney | 0 .00 RPM | 26 .66 RPM |
SRP017611_liver | 0 .00 RPM | 8 .71 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Loxodonta africana | ENSLAFG00000029544 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000013977 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000005642 | 4 retrocopies | |
Drosophila melanogaster | FBgn0051715 | 1 retrocopy |