RetrogeneDB ID: | retro_pabe_483 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 1:199254251..199254610(-) | ||
| Located in intron of: | ENSPPYG00000001621 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000015527 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.21 % |
| Parental protein coverage: | 68.6 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 2 |
| Parental | TPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGY-DEEYDCPILDED-RVVDELDNQMREGGVIVDY |
| T..VGKTT.GK.L.S..GLKYINVG..A...QLYDGY..EEYDCPILDED.RV.DE.DN.MREG....DY | |
| Retrocopy | TRRVGKTTQGKKLTSRPGLKYINVGGSA-QGQLYDGYNEEEYDCPILDED>RVIDESDNHMREGKDTADY |
| Parental | HGCDFFPERWFHIV-FVLRTDTN-VLYERLETRGYNEKKLTDNIQCEIFQVL |
| HGC.FFPE.W.HIV.FVLRTDTN........TRG...KKL.DNIQCEIF..L | |
| Retrocopy | HGCGFFPEHWLHIV>FVLRTDTNQCIVHKT*TRG*GQKKLKDNIQCEIFHSL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 18 .74 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 18 .73 RPM |
| SRP007412_heart | 0 .06 RPM | 8 .76 RPM |
| SRP007412_kidney | 0 .00 RPM | 14 .88 RPM |
| SRP007412_liver | 0 .06 RPM | 8 .48 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_134 |
| Pan troglodytes | retro_ptro_138 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000012471 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000036421 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000024524 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000015545 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016022 | 12 retrocopies | |
| Myotis lucifugus | ENSMLUG00000028932 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000019421 | 14 retrocopies | |
| Mustela putorius furo | ENSMPUG00000014588 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000078941 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004086 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000020970 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000027736 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000015527 | 3 retrocopies |
retro_pabe_3298, retro_pabe_483 , retro_pabe_835,
|
| Pan troglodytes | ENSPTRG00000016949 | 10 retrocopies | |
| Rattus norvegicus | ENSRNOG00000039848 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017216 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000024448 | 2 retrocopies |