RetrogeneDB ID: | retro_rnor_1328 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 18:6057026..6057446(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Mrps18b | ||
Ensembl ID: | ENSRNOG00000000804 | ||
Aliases: | Mrps18b, Ptd017 | ||
Description: | mitochondrial ribosomal protein S18B [Source:RefSeq peptide;Acc:NP_997699] |
Percent Identity: | 80.71 % |
Parental protein coverage: | 54.47 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | TRKTCIRKDKVAGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARE |
.R..C....KVAGNPCPIC.D.KLHVD.RNVKLLEQFVCAHTGIIF.A.YTGVCMKQHKKLTQAIQKAR. | |
Retrocopy | SRPECMNHNKVAGNPCPICQDQKLHVDIRNVKLLEQFVCAHTGIIFNASYTGVCMKQHKKLTQAIQKARK |
Parental | YGLLSYYVPQVEPRDADLRTVHGAVSVTPPAPTLLSGEPWYPWYSWQQPPERELSRLRRLYQGNLLEASG |
.GLL.YYVPQV.P.D.D.R.VHGAVSVTPP.PTLL.GEPWY.WYSWQQ.PERELSRLRRLYQGN.L..SG | |
Retrocopy | CGLLIYYVPQVQP*DVDFRIVHGAVSVTPPVPTLLLGEPWYLWYSWQQQPERELSRLRRLYQGNFLKESG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 19 .41 RPM |
SRP017611_kidney | 0 .00 RPM | 34 .89 RPM |
SRP017611_liver | 0 .00 RPM | 24 .47 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000005581 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000012457 | 10 retrocopies | |
Macaca mulatta | ENSMMUG00000006525 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000015933 | 1 retrocopy | |
Mus musculus | ENSMUSG00000024436 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005224 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000002149 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000016412 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000017932 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000000804 | 1 retrocopy |
retro_rnor_1328 ,
|
Ictidomys tridecemlineatus | ENSSTOG00000011853 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000003333 | 1 retrocopy |