RetrogeneDB ID: | retro_rnor_1546 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 2:161242350..161242532(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Cox16 | ||
Ensembl ID: | ENSRNOG00000047115 | ||
Aliases: | None | ||
Description: | COX16 cytochrome c oxidase assembly homolog [Source:RefSeq peptide;Acc:NP_001156625] |
Percent Identity: | 82.26 % |
Parental protein coverage: | 57.55 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MVAPAVLRALRKNK-TLRYGVPMLLLVVGGSFGLREFSQIRYDAVTIKIDPELEKKLKVNKI |
MVAPAVL..LRKN..TLR.GVP..L.VVGGSF.LREFSQIRYDAVTIKIDPELEKK.KVNK. | |
Retrocopy | MVAPAVLHSLRKNR<TLRHGVPLWLMVVGGSFSLREFSQIRYDAVTIKIDPELEKKMKVNKM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 7 .55 RPM |
SRP017611_kidney | 0 .00 RPM | 43 .40 RPM |
SRP017611_liver | 0 .07 RPM | 21 .31 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Homo sapiens | ENSG00000133983 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000011089 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000001776 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000028663 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000005951 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000006494 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000047115 | 1 retrocopy |
retro_rnor_1546 ,
|
Tarsius syrichta | ENSTSYG00000013313 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000014791 | 1 retrocopy |