RetrogeneDB ID: | retro_ogar_3045 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873702.1:2000809..2001050(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX16 | ||
Ensembl ID: | ENSOGAG00000028663 | ||
Aliases: | None | ||
Description: | COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:20213] |
Percent Identity: | 55.56 % |
Parental protein coverage: | 74.53 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | GGSFGLREFSQIRYDAVKIK-IDPELEK-RLKANKISLESEYEKIKDSTFDDWKNIRGPRPWEDPDFLQG |
GG..G.................DPEL.K.RLK..KI..ESE..KIKD.TFDD.KNIRG.R.WEDPD.LQG | |
Retrocopy | GGDRGVKTHAKTESHRSRMRQTDPELDK>RLKVSKIP*ESESKKIKDLTFDDGKNIRGFRHWEDPDLLQG |
Parental | RNPEILKTKTT |
.N..ILKTK.T | |
Retrocopy | *NLKILKTKAT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Homo sapiens | ENSG00000133983 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000011089 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000001776 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000028663 | 1 retrocopy |
retro_ogar_3045 ,
|
Pongo abelii | ENSPPYG00000005951 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000006494 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000047115 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000013313 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000014791 | 1 retrocopy |